(data stored in ACNUC9435 zone)

EMBL: AM039950.PE23

AM039950.PE23        Location/Qualifiers
FT   CDS             complement(19160..19486)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0023"
FT                   /product="putative PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19792"
FT                   /db_xref="GOA:Q3C0E0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19792.1"
FT                   /translation="MMRGDFVTIAMQGDFGKPRPALVIQANQFDEHTTVTVLPVTSTLV
FT                   AAPLLRITVHPSTDNGLLKPSQVMVDKAMTVKRDKIGRAFGRVDADALVEIERCLAVFL
FT                   GIAK"
     MMRGDFVTIA MQGDFGKPRP ALVIQANQFD EHTTVTVLPV TSTLVAAPLL RITVHPSTDN        60
     GLLKPSQVMV DKAMTVKRDK IGRAFGRVDA DALVEIERCL AVFLGIAK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page