(data stored in ACNUC9435 zone)

EMBL: AM039950.PE24

AM039950.PE24        Location/Qualifiers
FT   CDS             complement(19483..19809)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19793"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19793.1"
FT                   /translation="MSAASWGTKPEPQKVPLLLHVTKMRRKLVACNGEANMAHVNSRVQ
FT                   KHRDALRMAGLRPVQIWVPDTRRPDFAEECRRQCRLAAQADMEDTDMQRFMDEALADMD
FT                   GWTE"
     MSAASWGTKP EPQKVPLLLH VTKMRRKLVA CNGEANMAHV NSRVQKHRDA LRMAGLRPVQ        60
     IWVPDTRRPD FAEECRRQCR LAAQADMEDT DMQRFMDEAL ADMDGWTE                    108
//

If you have problems or comments...

PBIL Back to PBIL home page