(data stored in ACNUC9435 zone)

EMBL: AM039950.PE25

AM039950.PE25        Location/Qualifiers
FT   CDS             complement(19838..20434)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19794"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19794.1"
FT                   /translation="MPTSNGRYCRASDGRGQESRAGHGDHLPMGRSSRTPEHLAAIVKA
FT                   LWLRHGPRNLDDVGVMQQSIQQGGLMKVTTILLDTAGEIAHRMAISMNALMLTVAAEAR
FT                   QDMAREHGADWAAGAVTFFGTEILKAFQSNKPDRDREMERSMMSLAMAVWVCDSVYGGL
FT                   AAETFVASDLRFTITHDGIVRYDRLPKPDDRADHQ"
     MPTSNGRYCR ASDGRGQESR AGHGDHLPMG RSSRTPEHLA AIVKALWLRH GPRNLDDVGV        60
     MQQSIQQGGL MKVTTILLDT AGEIAHRMAI SMNALMLTVA AEARQDMARE HGADWAAGAV       120
     TFFGTEILKA FQSNKPDRDR EMERSMMSLA MAVWVCDSVY GGLAAETFVA SDLRFTITHD       180
     GIVRYDRLPK PDDRADHQ                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page