(data stored in ACNUC9435 zone)

EMBL: AM039950.PE27

AM039950.PE27        Location/Qualifiers
FT   CDS             complement(21350..21937)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0027"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19796"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19796.1"
FT                   /translation="MKKLIVALFIGAAAVSAHASEYGCKVLLCLANPASNGGPKGVSEC
FT                   VPPIDQLYHDLSKGRPFPTCDLADGNDGSSYARQVYDPYDPCPAPLQPAARGSYVVQGQ
FT                   KKTGTNKPGWWGGDGSYTLSGQPQVSQSQSDYGHSSGARACVGKSVGSYTVGSYDSSDT
FT                   VDVFDKVIWQPAQNPRAIDVFIDNTWQQRVRW"
     MKKLIVALFI GAAAVSAHAS EYGCKVLLCL ANPASNGGPK GVSECVPPID QLYHDLSKGR        60
     PFPTCDLADG NDGSSYARQV YDPYDPCPAP LQPAARGSYV VQGQKKTGTN KPGWWGGDGS       120
     YTLSGQPQVS QSQSDYGHSS GARACVGKSV GSYTVGSYDS SDTVDVFDKV IWQPAQNPRA       180
     IDVFIDNTWQ QRVRW                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page