(data stored in ACNUC9435 zone)

EMBL: AM039950.PE3

AM039950.PE3         Location/Qualifiers
FT   CDS             complement(3049..3264)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19772"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19772.1"
FT                   /translation="MSSIHESKVARHRERMRAAGLRPVQFWVPDTRSPEFAAQVRKQCQ
FT                   NLKGDPAETEVLRFTEEAATHVEGWE"
     MSSIHESKVA RHRERMRAAG LRPVQFWVPD TRSPEFAAQV RKQCQNLKGD PAETEVLRFT        60
     EEAATHVEGW E                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page