(data stored in ACNUC9435 zone)

EMBL: AM039950.PE34

AM039950.PE34        Location/Qualifiers
FT   CDS             complement(27468..27875)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0034"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19803"
FT                   /db_xref="GOA:Q3C0C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19803.1"
FT                   /translation="MPKALWTWILMGTAVVLIGGYGLLKIMSREPIIPMPVPQQGMPTP
FT                   SPSVETQNGGNPLLTADKVAVARWFPGHCFAELYNKDPSFGGRLIPSCVVKVIQQVKAD
FT                   TGVTLTEADIKSPDVLAHFKHVYGDDNQWRH"
     MPKALWTWIL MGTAVVLIGG YGLLKIMSRE PIIPMPVPQQ GMPTPSPSVE TQNGGNPLLT        60
     ADKVAVARWF PGHCFAELYN KDPSFGGRLI PSCVVKVIQQ VKADTGVTLT EADIKSPDVL       120
     AHFKHVYGDD NQWRH                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page