(data stored in ACNUC9435 zone)

EMBL: AM039950.PE36

AM039950.PE36        Location/Qualifiers
FT   CDS             complement(28767..29465)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19805"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19805.1"
FT                   /translation="MQQMTQQPLNDAQLDRLGDFLEGVGAPAMNLEMLDGFFAALICGP
FT                   ETVLPSEYLPQVFGEDHCFDSNDQAAEILGLVMRHWNTIASELFRTLEKDDVYLPVLLE
FT                   DADGAVHGNDWARGFMRGIQLRPNSWQELIGSEEFGGPMLPIMILTHEHDPDPAMRPPE
FT                   IAPDKRDELLQSLIAGLTHIYRYFASHRQLATQGPLRRQGPKIGRNDQCPCGSGRKYKH
FT                   CCATSAPTFH"
     MQQMTQQPLN DAQLDRLGDF LEGVGAPAMN LEMLDGFFAA LICGPETVLP SEYLPQVFGE        60
     DHCFDSNDQA AEILGLVMRH WNTIASELFR TLEKDDVYLP VLLEDADGAV HGNDWARGFM       120
     RGIQLRPNSW QELIGSEEFG GPMLPIMILT HEHDPDPAMR PPEIAPDKRD ELLQSLIAGL       180
     THIYRYFASH RQLATQGPLR RQGPKIGRND QCPCGSGRKY KHCCATSAPT FH               232
//

If you have problems or comments...

PBIL Back to PBIL home page