(data stored in ACNUC9435 zone)

EMBL: AM039950.PE39

AM039950.PE39        Location/Qualifiers
FT   CDS             complement(32883..33122)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19808"
FT                   /db_xref="GOA:Q3C0C4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19808.1"
FT                   /translation="MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYL
FT                   FERAVEQAKAATVGMGETELNDLIDEAVQWAREH"
     MNTVRWNIAV SPDVDQSVRM FIAAQGGGRK GDLSRFIEDA VRAYLFERAV EQAKAATVGM        60
     GETELNDLID EAVQWAREH                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page