(data stored in ACNUC9435 zone)

EMBL: AM039950.PE4

AM039950.PE4         Location/Qualifiers
FT   CDS             complement(3510..3836)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19773"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19773.1"
FT                   /translation="MSMKGKPNTAQFKPPKDPTAFLEGGEADKAEKPLVAPAAVATPPA
FT                   ATPPAAEEAQRYGRARVQKIFNFPEELADRLRREALKRSEEKGVRVTEKDIVIEALEAF
FT                   LNGI"
     MSMKGKPNTA QFKPPKDPTA FLEGGEADKA EKPLVAPAAV ATPPAATPPA AEEAQRYGRA        60
     RVQKIFNFPE ELADRLRREA LKRSEEKGVR VTEKDIVIEA LEAFLNGI                    108
//

If you have problems or comments...

PBIL Back to PBIL home page