(data stored in ACNUC9435 zone)

EMBL: AM039950.PE40

AM039950.PE40        Location/Qualifiers
FT   CDS             33337..34260
FT                   /transl_table=11
FT                   /locus_tag="XCVc0040"
FT                   /product="Site-specific recombinase / resolvase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19809"
FT                   /db_xref="GOA:Q3C0C3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19809.1"
FT                   /translation="MKIGYARVSTREQNPALQVDSLKAAGCERIYQDVASGAKTARPAL
FT                   DELLGQLRGGDVLVIWKLDRMGRSLKHLVELVGSLMERKVGLLSLNDPIDTTSAQGRFV
FT                   FNLFATLAEFERELIRERTQAGLTAARARGRVGGRPKGLSPQAEATALAAETLYRERKL
FT                   SVAAIAQKLHLSKSTLYSYLRHRGVEIGPYKQSAQSPINVSVVESGNADQPKVATILLT
FT                   LRIENNSKFVRGKKRSIEHVEFFDLAQYDATRRPNGEYELKVPYDTDEELDEAVNDLLT
FT                   DIACGADDRHCFSESHARMEGTDRHW"
     MKIGYARVST REQNPALQVD SLKAAGCERI YQDVASGAKT ARPALDELLG QLRGGDVLVI        60
     WKLDRMGRSL KHLVELVGSL MERKVGLLSL NDPIDTTSAQ GRFVFNLFAT LAEFERELIR       120
     ERTQAGLTAA RARGRVGGRP KGLSPQAEAT ALAAETLYRE RKLSVAAIAQ KLHLSKSTLY       180
     SYLRHRGVEI GPYKQSAQSP INVSVVESGN ADQPKVATIL LTLRIENNSK FVRGKKRSIE       240
     HVEFFDLAQY DATRRPNGEY ELKVPYDTDE ELDEAVNDLL TDIACGADDR HCFSESHARM       300
     EGTDRHW                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page