(data stored in ACNUC9435 zone)

EMBL: AM039950.PE43

AM039950.PE43        Location/Qualifiers
FT   CDS             complement(37738..37995)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19812.1"
FT                   /translation="MLTLTKKELAVLDEAQPDYAVYLVEAEHESSRWWRMTVKLPTHNK
FT                   AYEVVTALGKTKLWKRLDIAVDFIKESCPHTKTVFVVFAP"
     MLTLTKKELA VLDEAQPDYA VYLVEAEHES SRWWRMTVKL PTHNKAYEVV TALGKTKLWK        60
     RLDIAVDFIK ESCPHTKTVF VVFAP                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page