(data stored in ACNUC9435 zone)

EMBL: AM039950.PE5

AM039950.PE5         Location/Qualifiers
FT   CDS             complement(3833..4459)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0005"
FT                   /product="putative partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19774"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19774.1"
FT                   /translation="MVFACVNTKGGVGKTTTAVHLAVMLARQGKTLLIDGDPQASAASW
FT                   AAWRRETQYDPSPTTTCLAGKAILSEGKQLATGFEHVVVDAGGRDSVGLRSALLLAQRA
FT                   VIPVGASNLDAAAMTDLLEVVELARDYNPELDVRVLLTRIDPRTKDAAEMLEFLAEQKL
FT                   TVLPTKVCERVAFRRAIGEGATVQELGRDQAAIAEMEAFFKEVMQ"
     MVFACVNTKG GVGKTTTAVH LAVMLARQGK TLLIDGDPQA SAASWAAWRR ETQYDPSPTT        60
     TCLAGKAILS EGKQLATGFE HVVVDAGGRD SVGLRSALLL AQRAVIPVGA SNLDAAAMTD       120
     LLEVVELARD YNPELDVRVL LTRIDPRTKD AAEMLEFLAE QKLTVLPTKV CERVAFRRAI       180
     GEGATVQELG RDQAAIAEME AFFKEVMQ                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page