(data stored in ACNUC9435 zone)

EMBL: AM039950.PE6

AM039950.PE6         Location/Qualifiers
FT   CDS             complement(4663..4956)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19775"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19775.1"
FT                   /translation="MRLGTGPCATPTGLFGNNNTTILITKQLIAARFRLAVGAVRRNPV
FT                   GGGGRRRAGTVRSRQKTAPTAWRHILLNGHYTFQRSGKIIDLDALVAGLELG"
     MRLGTGPCAT PTGLFGNNNT TILITKQLIA ARFRLAVGAV RRNPVGGGGR RRAGTVRSRQ        60
     KTAPTAWRHI LLNGHYTFQR SGKIIDLDAL VAGLELG                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page