(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB1

AM039950.VIRB1       Location/Qualifiers
FT   CDS             complement(21983..22894)
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="XCVc0028"
FT                   /product="type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19797"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19797.1"
FT                   /translation="MQVRDVITMAAGLLAVVPLFAGAQTPAQPLPFEKLAAECAPDVHP
FT                   STLKGVVSTESSWNPYAIGVVGGRLDHQPRGLAEAVATARELDRQGFNFSMGLGQVNRY
FT                   NLAKYGESYETVFEPCRNLKAGSAILKDCFQRAKAQMGDDQHALRAAFSCYYSGNFTRG
FT                   FRADKAGQPSYVQKVVANATGAAQPIPVVPAVKPESSDGAVAVRPAGRAAGPAKQAATS
FT                   SQWVIFAEGSPQGGQSVVPTDAASAKEPAVKVQLVTPGAAPAVAAAPAERVQTQRQAQA
FT                   VPVQRATANSTQQDAPFVQFVH"
     MQVRDVITMA AGLLAVVPLF AGAQTPAQPL PFEKLAAECA PDVHPSTLKG VVSTESSWNP        60
     YAIGVVGGRL DHQPRGLAEA VATARELDRQ GFNFSMGLGQ VNRYNLAKYG ESYETVFEPC       120
     RNLKAGSAIL KDCFQRAKAQ MGDDQHALRA AFSCYYSGNF TRGFRADKAG QPSYVQKVVA       180
     NATGAAQPIP VVPAVKPESS DGAVAVRPAG RAAGPAKQAA TSSQWVIFAE GSPQGGQSVV       240
     PTDAASAKEP AVKVQLVTPG AAPAVAAAPA ERVQTQRQAQ AVPVQRATAN STQQDAPFVQ       300
     FVH                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page