(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB10

AM039950.VIRB10      Location/Qualifiers
FT   CDS             complement(23914..25134)
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="XCVc0030"
FT                   /product="type IV secretion system protein VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19799"
FT                   /db_xref="GOA:Q3C0D3"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19799.1"
FT                   /translation="MSDQTNKPQDDREAAVQAWEKQANASLVADDRKKKMSGIAIAAIA
FT                   AAALGAVWYMKHDGSEPAKPAGNSELSIPERKPVPKLKDQEPASVPAVTSAPAATPASA
FT                   AQADDPMKAQREQMEMQRREQERRILEARMKSAIIPPNSNNQAAASAQPVGDSGDQGPS
FT                   NAGALGGGSGERGAQDPNSRFARAVSGNGVAVSKANQIDNLPYKVLQGKLIEAVLEPRA
FT                   ISDLPGMVCATVQRDVYGEQDRNKLIPWGSRVCGVYSAEVRKGQDRLFVIWNTVRRPDG
FT                   VQVALDSAGADQLGTAGMGGIVDTHFAEIFGMSALLSIIGAGASNAGVSSGDQYNSTAA
FT                   YRQSVQQAAAQTSQSVLQPYINIPPTITVPAGSRVRIYVNKDLDFTPIYKDDIDAAKHG
FT                   DGVTFIP"
     MSDQTNKPQD DREAAVQAWE KQANASLVAD DRKKKMSGIA IAAIAAAALG AVWYMKHDGS        60
     EPAKPAGNSE LSIPERKPVP KLKDQEPASV PAVTSAPAAT PASAAQADDP MKAQREQMEM       120
     QRREQERRIL EARMKSAIIP PNSNNQAAAS AQPVGDSGDQ GPSNAGALGG GSGERGAQDP       180
     NSRFARAVSG NGVAVSKANQ IDNLPYKVLQ GKLIEAVLEP RAISDLPGMV CATVQRDVYG       240
     EQDRNKLIPW GSRVCGVYSA EVRKGQDRLF VIWNTVRRPD GVQVALDSAG ADQLGTAGMG       300
     GIVDTHFAEI FGMSALLSII GAGASNAGVS SGDQYNSTAA YRQSVQQAAA QTSQSVLQPY       360
     INIPPTITVP AGSRVRIYVN KDLDFTPIYK DDIDAAKHGD GVTFIP                      406
//

If you have problems or comments...

PBIL Back to PBIL home page