(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB11

AM039950.VIRB11      Location/Qualifiers
FT   CDS             complement(22881..23903)
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="XCVc0029"
FT                   /product="type IV secretion system protein VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19798"
FT                   /db_xref="GOA:Q3C0D4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19798.1"
FT                   /translation="MSQIASFRTKLSLLADHLDDKQVTEIQVNKPGELWLRKKDAYYAE
FT                   QIEVPGLTYQLLSSLAEVTASFKSLDVDRESPILSAEIPVNLDDGVPDFERGTYRTEMI
FT                   LPPVVPEGTIAMTIRKQSLVRMSLPKYKEQGAFRFVNSDVTDEPYSDARLLELYRAKEW
FT                   DQFLRGAVLAHKNIVISAGTYCGKTTCLNALVQEIPAHERIVTIEDSREIEPAQPNCVR
FT                   LSYARHQASGQAAVTPTTLLRSCMRLTPDRVIMGEIRGPEAVEFLNMLNTGHKGSLTTI
FT                   HTDSPAEMYDRFGELMDGHTSMTREQVIARVKRRIDVVVQWKYTERNGRYISEIIYAGA
FT                   "
     MSQIASFRTK LSLLADHLDD KQVTEIQVNK PGELWLRKKD AYYAEQIEVP GLTYQLLSSL        60
     AEVTASFKSL DVDRESPILS AEIPVNLDDG VPDFERGTYR TEMILPPVVP EGTIAMTIRK       120
     QSLVRMSLPK YKEQGAFRFV NSDVTDEPYS DARLLELYRA KEWDQFLRGA VLAHKNIVIS       180
     AGTYCGKTTC LNALVQEIPA HERIVTIEDS REIEPAQPNC VRLSYARHQA SGQAAVTPTT       240
     LLRSCMRLTP DRVIMGEIRG PEAVEFLNML NTGHKGSLTT IHTDSPAEMY DRFGELMDGH       300
     TSMTREQVIA RVKRRIDVVV QWKYTERNGR YISEIIYAGA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page