(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB2

AM039950.VIRB2       Location/Qualifiers
FT   CDS             complement(37332..37709)
FT                   /transl_table=11
FT                   /gene="virB2"
FT                   /locus_tag="XCVc0042"
FT                   /product="type IV secretion system protein VirB2"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19811"
FT                   /db_xref="GOA:Q3C0C1"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19811.1"
FT                   /translation="MEKNEAIEKDTAVGPRKGDKVDKALGLTANALVMALVFLPQLAYA
FT                   QDAGGTFGGITAFLKSITQLLIYEWGYYIGIITLAIQGYRWKSGRIDLMTLGGWGLGIG
FT                   LVFFAPNIVSDLKARSSGSIQ"
     MEKNEAIEKD TAVGPRKGDK VDKALGLTAN ALVMALVFLP QLAYAQDAGG TFGGITAFLK        60
     SITQLLIYEW GYYIGIITLA IQGYRWKSGR IDLMTLGGWG LGIGLVFFAP NIVSDLKARS       120
     SGSIQ                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page