(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB4

AM039950.VIRB4       Location/Qualifiers
FT   CDS             complement(34380..37013)
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /locus_tag="XCVc0041"
FT                   /product="type IV secretion system protein VirB4"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19810"
FT                   /db_xref="GOA:Q3C0C2"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19810.1"
FT                   /translation="MSLSMPVPEGAAADAKEMALSDMIPYTVHYDDESVITKDDGLVQV
FT                   IKLDGLYFESLTAEQIKQFERRRNTVLRSIANSDRGVYVHLIRRKVNLYPAGEGGTWFA
FT                   RRFNQAWRERYNKRSFYVNEIYISIVRNRFRQGAPGILDRAFSLLSGSKVTKEDLESFE
FT                   EQAKDVNEAANLVVQTLSGYGARKLRIQRRPEFVLDRVSRADAQLAVERFKMSWQEFQR
FT                   SHGHHDVYRRDEVLDYLGEDFTEIGGFLHYLVNLEDERVPVTEMQLDRTLAVSSLDFKM
FT                   LSNMMAVQNLSGTRAGAMLSMAEWPARTPSRMLDEFLKQPVEYIITQSFFFTDRISAEH
FT                   DMRQERRRIAVNDREGVAEEDKDEITKGLQDLTRGRSVNGLHHLTMLVHVPATTQFADP
FT                   IENKRQTIADLDGAVGLLKKAFVNLGVKPVREWFAVETFFWAQLPGQAQHFMGRRGKIK
FT                   SGNFAGFASLHNFAVGKIDGNLWGPAIMPFETESGTAYYFNFHREMEGMVAGHLALTAD
FT                   TGGGKTTLLAAFIAMADKARPRVFWFDNREGAKVFMRAMGGQHTTLTVQGNTGWNPMKL
FT                   PDTPENRAYLVELLTLMRTCYGGKLVPDDIDRFKKAVHENYALAYPDRRLRNVAWCFGQ
FT                   GELAKDMRVWHGANGIEGANWGVFDNAHDNIDLTKCRHYCYEMRQLIKDGSARPELPVV
FT                   LSYPFHRIEQSMNGEPFILVLEEGQNLVKHAYWREKIDSYIMQIRRKNGLLVFVTPDAK
FT                   YLYCETDSIQKQTATKIYLPNGEANRTDLVDVLGLTPGEYEFVRDTPPENRTFLIRRGN
FT                   ESIKAKFDLSDMPAFIPVLSSNDKGVALMDEIIRELETDDPEQWVPVFMERALAKNTHN
FT                   LKQKGA"
     MSLSMPVPEG AAADAKEMAL SDMIPYTVHY DDESVITKDD GLVQVIKLDG LYFESLTAEQ        60
     IKQFERRRNT VLRSIANSDR GVYVHLIRRK VNLYPAGEGG TWFARRFNQA WRERYNKRSF       120
     YVNEIYISIV RNRFRQGAPG ILDRAFSLLS GSKVTKEDLE SFEEQAKDVN EAANLVVQTL       180
     SGYGARKLRI QRRPEFVLDR VSRADAQLAV ERFKMSWQEF QRSHGHHDVY RRDEVLDYLG       240
     EDFTEIGGFL HYLVNLEDER VPVTEMQLDR TLAVSSLDFK MLSNMMAVQN LSGTRAGAML       300
     SMAEWPARTP SRMLDEFLKQ PVEYIITQSF FFTDRISAEH DMRQERRRIA VNDREGVAEE       360
     DKDEITKGLQ DLTRGRSVNG LHHLTMLVHV PATTQFADPI ENKRQTIADL DGAVGLLKKA       420
     FVNLGVKPVR EWFAVETFFW AQLPGQAQHF MGRRGKIKSG NFAGFASLHN FAVGKIDGNL       480
     WGPAIMPFET ESGTAYYFNF HREMEGMVAG HLALTADTGG GKTTLLAAFI AMADKARPRV       540
     FWFDNREGAK VFMRAMGGQH TTLTVQGNTG WNPMKLPDTP ENRAYLVELL TLMRTCYGGK       600
     LVPDDIDRFK KAVHENYALA YPDRRLRNVA WCFGQGELAK DMRVWHGANG IEGANWGVFD       660
     NAHDNIDLTK CRHYCYEMRQ LIKDGSARPE LPVVLSYPFH RIEQSMNGEP FILVLEEGQN       720
     LVKHAYWREK IDSYIMQIRR KNGLLVFVTP DAKYLYCETD SIQKQTATKI YLPNGEANRT       780
     DLVDVLGLTP GEYEFVRDTP PENRTFLIRR GNESIKAKFD LSDMPAFIPV LSSNDKGVAL       840
     MDEIIRELET DDPEQWVPVF MERALAKNTH NLKQKGA                                877
//

If you have problems or comments...

PBIL Back to PBIL home page