(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB5

AM039950.VIRB5       Location/Qualifiers
FT   CDS             complement(28134..28706)
FT                   /transl_table=11
FT                   /gene="virB5"
FT                   /locus_tag="XCVc0035"
FT                   /product="putative type IV secretion system protein VirB5"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19804"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19804.1"
FT                   /translation="MATVLQLQQQFQQLQEQYKTLKDQYAAVTGSYGRGQMGLSDSISS
FT                   ASVVPGSWQEVVAQQQSGAFGSKQAAYEKLINTMPQDLFANPQAQNATTYKMSTDAVRA
FT                   ALAGGDSLYAEVQTHLNNLARMSQQVDTTVNIKDAQDLQNRIAGENGMMQSAMAKLNAM
FT                   NMNLQANMVNQQNQATAANQNFYQWKK"
     MATVLQLQQQ FQQLQEQYKT LKDQYAAVTG SYGRGQMGLS DSISSASVVP GSWQEVVAQQ        60
     QSGAFGSKQA AYEKLINTMP QDLFANPQAQ NATTYKMSTD AVRAALAGGD SLYAEVQTHL       120
     NNLARMSQQV DTTVNIKDAQ DLQNRIAGEN GMMQSAMAKL NAMNMNLQAN MVNQQNQATA       180
     ANQNFYQWKK                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page