(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB6

AM039950.VIRB6       Location/Qualifiers
FT   CDS             complement(26614..27480)
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="XCVc0033"
FT                   /product="type IV secretion system protein VirB6"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19802"
FT                   /db_xref="GOA:Q3C0D0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19802.1"
FT                   /translation="MATLTIEGMIGSADGVTTSFLTQIYPALANAISTPIYLVAVLYWA
FT                   IYGYKIYAGYEPMKWNAVLSKAFMTTAVFSALNWGGLGQSIYGFFTSFMEGAASTIMAG
FT                   QSTPSMLDALYNNVGQVSALMQNVSWYQFGMILQGFGLFLINCILFILALVYMTIAKFG
FT                   LAITMVLLPIFVGFFFFEQTRQWAMNWLSKMLNFCFIYILVIAIVRFGFLAFGDAIDEA
FT                   GKAASVTDAARINVQQVAYLYIVEGVLIIFMLQVKGWAAALAGGASVQGVSLLMMVGRM
FT                   FTKGAIK"
     MATLTIEGMI GSADGVTTSF LTQIYPALAN AISTPIYLVA VLYWAIYGYK IYAGYEPMKW        60
     NAVLSKAFMT TAVFSALNWG GLGQSIYGFF TSFMEGAAST IMAGQSTPSM LDALYNNVGQ       120
     VSALMQNVSW YQFGMILQGF GLFLINCILF ILALVYMTIA KFGLAITMVL LPIFVGFFFF       180
     EQTRQWAMNW LSKMLNFCFI YILVIAIVRF GFLAFGDAID EAGKAASVTD AARINVQQVA       240
     YLYIVEGVLI IFMLQVKGWA AALAGGASVQ GVSLLMMVGR MFTKGAIK                    288
//

If you have problems or comments...

PBIL Back to PBIL home page