(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB8

AM039950.VIRB8       Location/Qualifiers
FT   CDS             complement(25943..26617)
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /locus_tag="XCVc0032"
FT                   /product="type IV secretion system protein VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19801"
FT                   /db_xref="GOA:Q3C0D1"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19801.1"
FT                   /translation="MNFGKGTFKGDNETQAAQLGGSNKLKQERNRAYLLIGLLLFVVGG
FT                   MASAVTVLANVHTVIPVVSVIDANGHVVKQQVVNKETITGQESFVQSQVYDFIMYCNTF
FT                   DPDWRQRFADLCRLHSTQAVAGQYDAETSPDNPNNPYYQLGQGGRRYPKITGITSLGKD
FT                   AYQVSFQSITEKAGSPPKTDYYTALVRYTFTFKPLALGDRWENALGYATTAYRKDQELS
FT                   RQ"
     MNFGKGTFKG DNETQAAQLG GSNKLKQERN RAYLLIGLLL FVVGGMASAV TVLANVHTVI        60
     PVVSVIDANG HVVKQQVVNK ETITGQESFV QSQVYDFIMY CNTFDPDWRQ RFADLCRLHS       120
     TQAVAGQYDA ETSPDNPNNP YYQLGQGGRR YPKITGITSL GKDAYQVSFQ SITEKAGSPP       180
     KTDYYTALVR YTFTFKPLAL GDRWENALGY ATTAYRKDQE LSRQ                        224
//

If you have problems or comments...

PBIL Back to PBIL home page