(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB9

AM039950.VIRB9       Location/Qualifiers
FT   CDS             complement(25136..25918)
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="XCVc0031"
FT                   /product="type IV secretion system protein VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19800"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19800.1"
FT                   /translation="MKFNPIALAVALIAGTSISLASVPAHAAKSPHALVTDDRVKQVPY
FT                   DPNQVYEIVGTYGYQTSIEFANDETVKVVTLGDSIAWQTVPYQNRLFLKPVEPNAATNL
FT                   TVITDKRTYYFKLTSSKSQAAMTFLVRFVYPNSNVKTYAGAGSAQRMSNGFDPAKLNLG
FT                   YGTSGNKTAIPLKRAFDDGQFTYFMFDQNAEIPSVYTVGPDGTETIVNTRREGQYLVVE
FT                   RTASLFTLRNGNAHLCVQNNANPYKRAVSGLVSTGGGN"
     MKFNPIALAV ALIAGTSISL ASVPAHAAKS PHALVTDDRV KQVPYDPNQV YEIVGTYGYQ        60
     TSIEFANDET VKVVTLGDSI AWQTVPYQNR LFLKPVEPNA ATNLTVITDK RTYYFKLTSS       120
     KSQAAMTFLV RFVYPNSNVK TYAGAGSAQR MSNGFDPAKL NLGYGTSGNK TAIPLKRAFD       180
     DGQFTYFMFD QNAEIPSVYT VGPDGTETIV NTRREGQYLV VERTASLFTL RNGNAHLCVQ       240
     NNANPYKRAV SGLVSTGGGN                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page