(data stored in ACNUC9435 zone)

EMBL: AM039951.AVRBS1

AM039951.AVRBS1      Location/Qualifiers
FT   CDS             complement(113115..114452)
FT                   /transl_table=11
FT                   /gene="avrBs1"
FT                   /locus_tag="XCVd0104"
FT                   /product="avirulence protein AvrBs1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19916"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C000"
FT                   /protein_id="CAJ19916.1"
FT                   /translation="MSDMKVNFSSKIIDSTPSEEEVATQQDSYTKSGLVAPSLDSQALK
FT                   KAPRKRVIKENIAALHTSSLERVHQKKVLVQNLAQLQRGLAKINGRVELEELIDGFSVK
FT                   ELLIKRNPKIAEEYGEGNPLMIRSLRFSNPQEVTSKLGAEGKTPAKREVDTICNKSTLH
FT                   DIVMTPASLVKKEVRMNLISEVPRAKDKQKYRGLPSVVYGQSSRRSESDYLTSRNGFGD
FT                   VHSFKSNNAFNSDYEKICGSLSHAEKLGLIERNLTPFIRHDPDRISTDFVHSIEELAEH
FT                   QMLLQSRKPASALRHNEYCTKLELWDAKAIAVGESRALAVATLIEFNLEMLSIAQEIDD
FT                   DGHKSKMVADFIERQLSWLGPQTALDSKSTLERVSAVTIQEREFIANEISRSLRQGVSL
FT                   CTYDKDEAGSHIREMSLLDFRVEEIIEGISIFISSKLLHVTNAGEA"
     MSDMKVNFSS KIIDSTPSEE EVATQQDSYT KSGLVAPSLD SQALKKAPRK RVIKENIAAL        60
     HTSSLERVHQ KKVLVQNLAQ LQRGLAKING RVELEELIDG FSVKELLIKR NPKIAEEYGE       120
     GNPLMIRSLR FSNPQEVTSK LGAEGKTPAK REVDTICNKS TLHDIVMTPA SLVKKEVRMN       180
     LISEVPRAKD KQKYRGLPSV VYGQSSRRSE SDYLTSRNGF GDVHSFKSNN AFNSDYEKIC       240
     GSLSHAEKLG LIERNLTPFI RHDPDRISTD FVHSIEELAE HQMLLQSRKP ASALRHNEYC       300
     TKLELWDAKA IAVGESRALA VATLIEFNLE MLSIAQEIDD DGHKSKMVAD FIERQLSWLG       360
     PQTALDSKST LERVSAVTIQ EREFIANEIS RSLRQGVSLC TYDKDEAGSH IREMSLLDFR       420
     VEEIIEGISI FISSKLLHVT NAGEA                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page