(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTA

AM039951.DOTA        Location/Qualifiers
FT   CDS             complement(32545..35127)
FT                   /transl_table=11
FT                   /gene="dotA"
FT                   /locus_tag="XCVd0027"
FT                   /product="putative TraY/DotA-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19839"
FT                   /db_xref="GOA:Q3C077"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C077"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19839.1"
FT                   /translation="MAAPTPMKPGRSPEPRPPHVASFVRHQGTPRSGAKLSPAARGGET
FT                   RCHRACSACGAAMAGLGHPTHLAPKHHRWNFWLHAHFPFPCPVTPKCRRYFRGHHALTW
FT                   SYSMTRSLAVLGALMIPNLARAQDPSKPGFFKPPADDTSVSFIRDVFGSIVDTIMTGQN
FT                   VDQASADTALAAGFEVFGLGILALGMLFVIFTTVKGAVDTAHDGEFLGKKMSSVWVPLR
FT                   TAAGTAFLLPLKSGFSLVQIAVLWIGIHGVGLADQVWLAMLDKMVETGQMGRPHLPDSR
FT                   PLAANILRYEVCAAAMNKQYETEGRALKIEVLPKKTAMINTGDALKFDNILYPGGFLDL
FT                   AQSAAGSAFSVTGLQWSAVGSGGYMNQNVCGELEWQESHESSESNGAPYIDKAPILRAQ
FT                   AQAVQKMVSELRPVAQAIVAGEKPAAGALERVANTYELSLQTAALSVVNRANKNRNSRF
FT                   LTYAKEGGWIFAGTYYNHIIHMSDAIQSAVNSLPASSAQTITDKEAADTLILYQDSLVT
FT                   ANEYIRNSSQSAYRAYEAQNQAIGFTGDKIPSNFEEMKIWLSRPALAGINQMTQEIAGS
FT                   NLSHVAQMKNVGDTIMAVAWTIQGAQFIVAGFGGGLWDDAVTLGSYDIGASIETLTPAV
FT                   AFLFMTLLTAGAFLAFYVPMIPYIIWITGIIKWLTVLFESVIAAPIWAAAHVHPDGDDQ
FT                   GGRAGPGYMIILSVFLRPTLMIFGLVGSIVVAQPVAHYVNLTYITQVQGAMGNSANAIG
FT                   ALIAYTAIYAILMTIVLHSVFGFINWIPDNVLRWIGSAVGMHGIADNEEHGVKGAFFRS
FT                   TESVSKGTGSHKPSGGGGGGSKPVNTGGSEPGGGGTGNDVHSTKLPGA"
     MAAPTPMKPG RSPEPRPPHV ASFVRHQGTP RSGAKLSPAA RGGETRCHRA CSACGAAMAG        60
     LGHPTHLAPK HHRWNFWLHA HFPFPCPVTP KCRRYFRGHH ALTWSYSMTR SLAVLGALMI       120
     PNLARAQDPS KPGFFKPPAD DTSVSFIRDV FGSIVDTIMT GQNVDQASAD TALAAGFEVF       180
     GLGILALGML FVIFTTVKGA VDTAHDGEFL GKKMSSVWVP LRTAAGTAFL LPLKSGFSLV       240
     QIAVLWIGIH GVGLADQVWL AMLDKMVETG QMGRPHLPDS RPLAANILRY EVCAAAMNKQ       300
     YETEGRALKI EVLPKKTAMI NTGDALKFDN ILYPGGFLDL AQSAAGSAFS VTGLQWSAVG       360
     SGGYMNQNVC GELEWQESHE SSESNGAPYI DKAPILRAQA QAVQKMVSEL RPVAQAIVAG       420
     EKPAAGALER VANTYELSLQ TAALSVVNRA NKNRNSRFLT YAKEGGWIFA GTYYNHIIHM       480
     SDAIQSAVNS LPASSAQTIT DKEAADTLIL YQDSLVTANE YIRNSSQSAY RAYEAQNQAI       540
     GFTGDKIPSN FEEMKIWLSR PALAGINQMT QEIAGSNLSH VAQMKNVGDT IMAVAWTIQG       600
     AQFIVAGFGG GLWDDAVTLG SYDIGASIET LTPAVAFLFM TLLTAGAFLA FYVPMIPYII       660
     WITGIIKWLT VLFESVIAAP IWAAAHVHPD GDDQGGRAGP GYMIILSVFL RPTLMIFGLV       720
     GSIVVAQPVA HYVNLTYITQ VQGAMGNSAN AIGALIAYTA IYAILMTIVL HSVFGFINWI       780
     PDNVLRWIGS AVGMHGIADN EEHGVKGAFF RSTESVSKGT GSHKPSGGGG GGSKPVNTGG       840
     SEPGGGGTGN DVHSTKLPGA                                                   860
//

If you have problems or comments...

PBIL Back to PBIL home page