(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTB

AM039951.DOTB        Location/Qualifiers
FT   CDS             7844..9040
FT                   /transl_table=11
FT                   /gene="dotB"
FT                   /locus_tag="XCVd0007"
FT                   /product="putative DotB-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19819"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C097"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19819.1"
FT                   /translation="MNAVLSDQSLIERALLRSEPTVFDEIGVQQLLVHAKAMGASDVYI
FT                   KTNARVTARIHGRLYRLTRRTLYATEVGSIAGYLYGGPNAEVQLKRGMDLDNAYTFRLN
FT                   RSDSLRFRWNATGAEIDGSFGISIILRELPEIPPAIDKEDLGDDLYGALYPDDGIVMVC
FT                   GPTGSGKSTLLAGMIRDIAENPDSHCHIITYESPVEFVYDKVEKPTTEIESTSIPDHLP
FT                   NFAAAIRNSLRRDPDIIVVGEMRDGETIGAAILASQTGHVVYGTAHSTSVGATFTRTMQ
FT                   SLPKNEQQGMLGGLIDSLRLIICQELVQSTDGKRVALREYLSFGESERRALLTAAMRDP
FT                   AGVPSVAQQLTRERGQTKLMHARKLFAAGRIKEDVVLRFELAEQTARAQVSLLAGEGE"
     MNAVLSDQSL IERALLRSEP TVFDEIGVQQ LLVHAKAMGA SDVYIKTNAR VTARIHGRLY        60
     RLTRRTLYAT EVGSIAGYLY GGPNAEVQLK RGMDLDNAYT FRLNRSDSLR FRWNATGAEI       120
     DGSFGISIIL RELPEIPPAI DKEDLGDDLY GALYPDDGIV MVCGPTGSGK STLLAGMIRD       180
     IAENPDSHCH IITYESPVEF VYDKVEKPTT EIESTSIPDH LPNFAAAIRN SLRRDPDIIV       240
     VGEMRDGETI GAAILASQTG HVVYGTAHST SVGATFTRTM QSLPKNEQQG MLGGLIDSLR       300
     LIICQELVQS TDGKRVALRE YLSFGESERR ALLTAAMRDP AGVPSVAQQL TRERGQTKLM       360
     HARKLFAAGR IKEDVVLRFE LAEQTARAQV SLLAGEGE                               398
//

If you have problems or comments...

PBIL Back to PBIL home page