(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTC

AM039951.DOTC        Location/Qualifiers
FT   CDS             7068..7847
FT                   /transl_table=11
FT                   /gene="dotC"
FT                   /locus_tag="XCVd0006"
FT                   /product="putative DotC-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19818"
FT                   /db_xref="InterPro:IPR031618"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C098"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19818.1"
FT                   /translation="MAVSDAPPNLDQALGAFERNGAEVRVIDAVGELRASAIREDGLSY
FT                   GVRAGLARRSFEIQQLLAKQAPQLDRAFDFGSLLMDRNVLPPVLTEASQVVHSEGTDVL
FT                   RVTDKIYAIARQAQFVTAAPTWRSYVVTEATFSYDPPEPYMAPKSGDERTVWKQAVTTG
FT                   WKAGEQQADQILTESLNRLKRDYQGMLLYRRLLQQGVVSKPYVAEANYGITGDGDKVNI
FT                   NERMLRITALPKMQPHTQWKPIAVPAKPIQPTVRVNP"
     MAVSDAPPNL DQALGAFERN GAEVRVIDAV GELRASAIRE DGLSYGVRAG LARRSFEIQQ        60
     LLAKQAPQLD RAFDFGSLLM DRNVLPPVLT EASQVVHSEG TDVLRVTDKI YAIARQAQFV       120
     TAAPTWRSYV VTEATFSYDP PEPYMAPKSG DERTVWKQAV TTGWKAGEQQ ADQILTESLN       180
     RLKRDYQGML LYRRLLQQGV VSKPYVAEAN YGITGDGDKV NINERMLRIT ALPKMQPHTQ       240
     WKPIAVPAKP IQPTVRVNP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page