(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTD

AM039951.DOTD        Location/Qualifiers
FT   CDS             6587..7081
FT                   /transl_table=11
FT                   /gene="dotD"
FT                   /locus_tag="XCVd0005"
FT                   /product="putative DotD-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19817"
FT                   /db_xref="InterPro:IPR031817"
FT                   /db_xref="InterPro:IPR038140"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C099"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19817.1"
FT                   /translation="MRRYQAVLLATCAALSAGCATTRSAGPSASDPAQENLTAAASAIQ
FT                   QSLRDLSEAEQYDKMRAVPGTPRLRTQIPGLERMVTMPWNGPLEPAVMRLAAEGGYEFK
FT                   LLGRQPAVGIVVQVGPEPATISDHLRNLGIQAGTRADIAIEPTAGGRRGIIAIEYSNGG
FT                   L"
     MRRYQAVLLA TCAALSAGCA TTRSAGPSAS DPAQENLTAA ASAIQQSLRD LSEAEQYDKM        60
     RAVPGTPRLR TQIPGLERMV TMPWNGPLEP AVMRLAAEGG YEFKLLGRQP AVGIVVQVGP       120
     EPATISDHLR NLGIQAGTRA DIAIEPTAGG RRGIIAIEYS NGGL                        164
//

If you have problems or comments...

PBIL Back to PBIL home page