(data stored in ACNUC9435 zone)

EMBL: AM039951.DSBC

AM039951.DSBC        Location/Qualifiers
FT   CDS             144018..144770
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="XCVd0137"
FT                   /product="thiol:disulfide interchange protein"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19949"
FT                   /db_xref="GOA:Q3BZW7"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19949.1"
FT                   /translation="MNRLALPLLLTLSLAACGDDSTPNASSGLDLAQAAVSKLAPHAKV
FT                   TGVERAAVPGLLQVTVDGSQVIYISENGQHLLAGQIIELASKDNLTERATSALHRKMLA
FT                   ELPPERKIVYAAEDPKHTVTVFTDVDCGYCRMLHEHIPDYNKAGISIEYVLYPRSGLQS
FT                   PTYATSVSVWCAQDRKQALIAVSTGGELTPAQCTNPVAEDYALGQRLGVTATPAIFAED
FT                   GRQVGGLLPPAQLLAVLDGRAQRGPTQP"
     MNRLALPLLL TLSLAACGDD STPNASSGLD LAQAAVSKLA PHAKVTGVER AAVPGLLQVT        60
     VDGSQVIYIS ENGQHLLAGQ IIELASKDNL TERATSALHR KMLAELPPER KIVYAAEDPK       120
     HTVTVFTDVD CGYCRMLHEH IPDYNKAGIS IEYVLYPRSG LQSPTYATSV SVWCAQDRKQ       180
     ALIAVSTGGE LTPAQCTNPV AEDYALGQRL GVTATPAIFA EDGRQVGGLL PPAQLLAVLD       240
     GRAQRGPTQP                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page