(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMB

AM039951.ICMB        Location/Qualifiers
FT   CDS             complement(169614..172661)
FT                   /transl_table=11
FT                   /gene="icmB"
FT                   /locus_tag="XCVd0162"
FT                   /product="putative IcmB-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19974.1"
FT                   /translation="MKIVEQIADIAEGALAYFSSSVKQSVADYLDIEYTEDETTFVLKD
FT                   GSRMTLLRVNGSRRMIGVDEFREIDGRLTNSLKAFMRGGGHALSCIFESDPDLVEREVR
FT                   EAQKPMRDTAVRIGLNLEDLFEEDVAMLRESCSAERCWVALYTRPSAFTATELKRDVAA
FT                   RMELLKDNPIPTMEDAPNLFRVIAGLKSRHDSFVSSFMQEMAAAEISLVQLEVHDACRD
FT                   MRMSIDREFTAAEWRPSLPGDKIPVREQRRNPADMSGALWPRLDRQLAPRNIREESSTS
FT                   CTVGSIAYKPMYIFMHQSGSETVPFQALFRRVRDTRAPWRIKFQIESGGLTSLGFKRLI
FT                   TAIIGFTNPENGLMRAAADRIEYLVREQNELDVKLRVDLTSWAPAGNAKLLEDRTSKLA
FT                   RAVQAWGGTDVRELSGDPVQALVATTPGLSLNSPATVACAALADVTQMLSFYRPASPWD
FT                   FGALMFNSPDGKLFPFQPSSSVQSNWINTVIAEPRAGKSVLVNAMNLAFTLSPGLTDLP
FT                   YIAIIDIGRSSSGFTSLIREAATEQSKHQVVQFRMRMRPEDSVNPFDTQLGCRRPLPHE
FT                   EALAVNFTTLLMTPPGEPHPADGMAGLCAGVIDYAYKHFADNAQPRRYSPQTEGAELVD
FT                   RAIVAHGLHVDRNTTWWEIVDQLFSRGDIHAASLAQRYAVPTLTDLAAVSRERQFSDLY
FT                   GEKLTNSGEPLLQAFARMLSEAIRRYPILSRPTAFDVGDARIVSIDLDEVAKQGSAVAD
FT                   HQTNVCYMLARHAAARNFYLREEHIDSFPPEYKGHHEQRIREIRQNRKHLVFDEVHRTS
FT                   KAAAVQNQLELDAREGGKWGVMLTLISHRPQDFPEAVLSFSTGNFVLSPTDDDSAELMR
FT                   DKWQASPTVLHAAKKHIRPPTAKDGSTMVVIFKTRSGPVTQLLNLKMGGIRLWAFSTSN
FT                   EDSYVRDVLYSQIGGQETRRLLAALYPAGTLLPEIERRKLALQNSGVMVDSEKEDGVIN
FT                   ELIREIKGKYDAARLQGAVAQGDRRA"
     MKIVEQIADI AEGALAYFSS SVKQSVADYL DIEYTEDETT FVLKDGSRMT LLRVNGSRRM        60
     IGVDEFREID GRLTNSLKAF MRGGGHALSC IFESDPDLVE REVREAQKPM RDTAVRIGLN       120
     LEDLFEEDVA MLRESCSAER CWVALYTRPS AFTATELKRD VAARMELLKD NPIPTMEDAP       180
     NLFRVIAGLK SRHDSFVSSF MQEMAAAEIS LVQLEVHDAC RDMRMSIDRE FTAAEWRPSL       240
     PGDKIPVREQ RRNPADMSGA LWPRLDRQLA PRNIREESST SCTVGSIAYK PMYIFMHQSG       300
     SETVPFQALF RRVRDTRAPW RIKFQIESGG LTSLGFKRLI TAIIGFTNPE NGLMRAAADR       360
     IEYLVREQNE LDVKLRVDLT SWAPAGNAKL LEDRTSKLAR AVQAWGGTDV RELSGDPVQA       420
     LVATTPGLSL NSPATVACAA LADVTQMLSF YRPASPWDFG ALMFNSPDGK LFPFQPSSSV       480
     QSNWINTVIA EPRAGKSVLV NAMNLAFTLS PGLTDLPYIA IIDIGRSSSG FTSLIREAAT       540
     EQSKHQVVQF RMRMRPEDSV NPFDTQLGCR RPLPHEEALA VNFTTLLMTP PGEPHPADGM       600
     AGLCAGVIDY AYKHFADNAQ PRRYSPQTEG AELVDRAIVA HGLHVDRNTT WWEIVDQLFS       660
     RGDIHAASLA QRYAVPTLTD LAAVSRERQF SDLYGEKLTN SGEPLLQAFA RMLSEAIRRY       720
     PILSRPTAFD VGDARIVSID LDEVAKQGSA VADHQTNVCY MLARHAAARN FYLREEHIDS       780
     FPPEYKGHHE QRIREIRQNR KHLVFDEVHR TSKAAAVQNQ LELDAREGGK WGVMLTLISH       840
     RPQDFPEAVL SFSTGNFVLS PTDDDSAELM RDKWQASPTV LHAAKKHIRP PTAKDGSTMV       900
     VIFKTRSGPV TQLLNLKMGG IRLWAFSTSN EDSYVRDVLY SQIGGQETRR LLAALYPAGT       960
     LLPEIERRKL ALQNSGVMVD SEKEDGVINE LIREIKGKYD AARLQGAVAQ GDRRA           1015
//

If you have problems or comments...

PBIL Back to PBIL home page