(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMC

AM039951.ICMC        Location/Qualifiers
FT   CDS             complement(175361..175891)
FT                   /transl_table=11
FT                   /gene="icmC"
FT                   /locus_tag="XCVd0166"
FT                   /product="putative IcmC-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19978"
FT                   /db_xref="GOA:Q3BZT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19978.1"
FT                   /translation="MNDVSQMLANLEGVAPYVSALIQTIASLMGVLFTVQGLYKFKQHT
FT                   ERGEAHLGTAFLYLVSGVALVNLALSTDAAFGLLYGNSGASVQHLVAYKPTDSMPTQAA
FT                   MVMKVIVLLLQVYGLFFTVTGWVQVRKLNDNRSGGEVTFRSTMFRILGGAALLNIVLTV
FT                   NTLAKLLGFGRVF"
     MNDVSQMLAN LEGVAPYVSA LIQTIASLMG VLFTVQGLYK FKQHTERGEA HLGTAFLYLV        60
     SGVALVNLAL STDAAFGLLY GNSGASVQHL VAYKPTDSMP TQAAMVMKVI VLLLQVYGLF       120
     FTVTGWVQVR KLNDNRSGGE VTFRSTMFRI LGGAALLNIV LTVNTLAKLL GFGRVF           176
//

If you have problems or comments...

PBIL Back to PBIL home page