(data stored in ACNUC9435 zone)

EMBL: AM039951.ICME

AM039951.ICME        Location/Qualifiers
FT   CDS             complement(176852..178099)
FT                   /transl_table=11
FT                   /gene="icmE"
FT                   /locus_tag="XCVd0168"
FT                   /product="putative IcmE-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19980"
FT                   /db_xref="GOA:Q3BZT6"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19980.1"
FT                   /translation="MMAQQESDIKLRAGNIASALKHGPTRLIFIGGIVLSLVVVVLAFS
FT                   FMGGGKPANNGEVVLESVPEPTVAPSGQTLTNTKAYEALAQQSDIQALKQAQQTGGTAM
FT                   PMPRPGQAAAEAKGEVTIDGTGVNMNAVPEPAAAAATTAQAQSAEATARLQQHEQQVQA
FT                   RYAIMSKQYDNLVGRWISVQTPVSVAVNQERKAGEAEDAQVGSASVASTASDDMAETTS
FT                   GALLRANDTYLGITLGDATTDDRLPLVRARILNGPGKGSVMRGTIETSEFAPGGFIHFT
FT                   SLTPPSGAQKRDAVEIDAVAIDPTTSRASVGDVNRHTASRMASLFFSSVLSGVSEGLIA
FT                   GGQQENVVTTGQTVVVQKDAFNDRQLALVGLGKVGTNATQMLQPTINRKPTASIGQKTE
FT                   IGVLFLSDVPASAFGK"
     MMAQQESDIK LRAGNIASAL KHGPTRLIFI GGIVLSLVVV VLAFSFMGGG KPANNGEVVL        60
     ESVPEPTVAP SGQTLTNTKA YEALAQQSDI QALKQAQQTG GTAMPMPRPG QAAAEAKGEV       120
     TIDGTGVNMN AVPEPAAAAA TTAQAQSAEA TARLQQHEQQ VQARYAIMSK QYDNLVGRWI       180
     SVQTPVSVAV NQERKAGEAE DAQVGSASVA STASDDMAET TSGALLRAND TYLGITLGDA       240
     TTDDRLPLVR ARILNGPGKG SVMRGTIETS EFAPGGFIHF TSLTPPSGAQ KRDAVEIDAV       300
     AIDPTTSRAS VGDVNRHTAS RMASLFFSSV LSGVSEGLIA GGQQENVVTT GQTVVVQKDA       360
     FNDRQLALVG LGKVGTNATQ MLQPTINRKP TASIGQKTEI GVLFLSDVPA SAFGK            415
//

If you have problems or comments...

PBIL Back to PBIL home page