(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMG

AM039951.ICMG        Location/Qualifiers
FT   CDS             complement(175901..176722)
FT                   /transl_table=11
FT                   /gene="icmG"
FT                   /locus_tag="XCVd0167"
FT                   /product="putative IcmG-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19979"
FT                   /db_xref="GOA:Q3BZT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19979.1"
FT                   /translation="MAKYMLIGFVVLIVAFVGWFGYKLMNRGGAATDTLSIPVQEQAAV
FT                   PMTGAPATAVNPYGVPGETANGQIAASAAADAPVSLTADQGTPGGGESAPAQQNDHAAG
FT                   VQAEQQIAQPQSAAQQPPVAVATSQSSATPQATPASDQSAVAETELEALRARVMELEKR
FT                   VATMTASGRAVATAPRTQPARRNAAPARPKSRDSATRPAPSSVTAAAKPEPVPASGIQL
FT                   KAVLEGRAWLQLKNGETVSVAPGDTIPGAGTVSAVDVERNEVRLNNGTSLR"
     MAKYMLIGFV VLIVAFVGWF GYKLMNRGGA ATDTLSIPVQ EQAAVPMTGA PATAVNPYGV        60
     PGETANGQIA ASAAADAPVS LTADQGTPGG GESAPAQQND HAAGVQAEQQ IAQPQSAAQQ       120
     PPVAVATSQS SATPQATPAS DQSAVAETEL EALRARVMEL EKRVATMTAS GRAVATAPRT       180
     QPARRNAAPA RPKSRDSATR PAPSSVTAAA KPEPVPASGI QLKAVLEGRA WLQLKNGETV       240
     SVAPGDTIPG AGTVSAVDVE RNEVRLNNGT SLR                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page