(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMK

AM039951.ICMK        Location/Qualifiers
FT   CDS             complement(178096..179037)
FT                   /transl_table=11
FT                   /gene="icmK"
FT                   /locus_tag="XCVd0169"
FT                   /product="putative IcmK-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19981"
FT                   /db_xref="InterPro:IPR022073"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19981.1"
FT                   /translation="MILGRMFLASAALLASAAAMAQAPAAAAAGAAAVPLQQAPAAPPA
FT                   GTTVPAPGLPILPEVNEVAFDRVKANAAPLTPEQIRDLRRLVDDAERAASIAARGTPRP
FT                   VSTSVVANLAPGAEPAVVRLAYGAVTNVLFVDGIGNALPITSPDLMKGGFDAFPVAENS
FT                   NVLKLFPTQPYATGNISVSLKGVSAPVPLMLITGQREVDYRVDVRVIGGNIAQKLAGSG
FT                   SAGSAVTTTMLEFITGAIPQGAVALKSDSPDVQAWAYNGAYYVKTPLTLLSPAYRNPGK
FT                   SPDGTSYYEIPPTPIVVVSISGSPKHVKIEAP"
     MILGRMFLAS AALLASAAAM AQAPAAAAAG AAAVPLQQAP AAPPAGTTVP APGLPILPEV        60
     NEVAFDRVKA NAAPLTPEQI RDLRRLVDDA ERAASIAARG TPRPVSTSVV ANLAPGAEPA       120
     VVRLAYGAVT NVLFVDGIGN ALPITSPDLM KGGFDAFPVA ENSNVLKLFP TQPYATGNIS       180
     VSLKGVSAPV PLMLITGQRE VDYRVDVRVI GGNIAQKLAG SGSAGSAVTT TMLEFITGAI       240
     PQGAVALKSD SPDVQAWAYN GAYYVKTPLT LLSPAYRNPG KSPDGTSYYE IPPTPIVVVS       300
     ISGSPKHVKI EAP                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page