(data stored in ACNUC9435 zone)

EMBL: AM039951.ICML

AM039951.ICML        Location/Qualifiers
FT   CDS             complement(179034..179867)
FT                   /transl_table=11
FT                   /gene="icmL"
FT                   /locus_tag="XCVd0170"
FT                   /product="putative IcmL-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19982"
FT                   /db_xref="InterPro:IPR021055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19982.1"
FT                   /translation="MQSVSNYAVLPTAKGHIRWHISLTRLLWCRILVNDFQTVVARRMD
FT                   DSPKPPASSKAKPDAVSPLGGYPPLAIDVAKLAFYGRHFGKLVAAILILSFAQCAQVGW
FT                   NMFKERREVRREYFGVDFKTGRMVRLVPLNEPYLAKPAMLTRVQECVQGANTYDFVNFQ
FT                   QSFQSISTCFTDGGWNAFAQELERVGTLKAVRRQRLVTQAVATGVPVIIGEQQIGGVLT
FT                   YTVQMPIRVSFQGGEGGRGLATQNLLITATVQRVPEYENQYGIGISAYTAEERRQ"
     MQSVSNYAVL PTAKGHIRWH ISLTRLLWCR ILVNDFQTVV ARRMDDSPKP PASSKAKPDA        60
     VSPLGGYPPL AIDVAKLAFY GRHFGKLVAA ILILSFAQCA QVGWNMFKER REVRREYFGV       120
     DFKTGRMVRL VPLNEPYLAK PAMLTRVQEC VQGANTYDFV NFQQSFQSIS TCFTDGGWNA       180
     FAQELERVGT LKAVRRQRLV TQAVATGVPV IIGEQQIGGV LTYTVQMPIR VSFQGGEGGR       240
     GLATQNLLIT ATVQRVPEYE NQYGIGISAY TAEERRQ                                277
//

If you have problems or comments...

PBIL Back to PBIL home page