(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMO

AM039951.ICMO        Location/Qualifiers
FT   CDS             47904..50471
FT                   /transl_table=11
FT                   /gene="icmO"
FT                   /locus_tag="XCVd0043"
FT                   /product="putative IcmO-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19855"
FT                   /db_xref="GOA:Q3C061"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C061"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19855.1"
FT                   /translation="MSIQGVDKRNEISRERLIRDTRPFFLRLLAGLGAPFAVAVAGLVL
FT                   CVIAVFVPALADVCLLVGLLYALIPRRGVEDVPFRVPKYSGGVDPNEIDSKTGKPKRGR
FT                   GIAFMGNRGQDDAECWGADTDVKRHWFFLGSTGAGKTEGLVSMCINAFIWVSGLLYTDG
FT                   KGDVSLYGKLFSSARIFGREDDFLLLNFMTGNADTQRKRSDKLSNNYNPFVDGNAASKT
FT                   QLLVNLMDSGGDGKGGDVWKGRAISFIATVMPALIDKRDAGSLLLHVGRIREYLPFLKL
FT                   LELLRDPDVLQDNKTRINAFLLDVPGYRADKGEQQANTFFEQYGYQQMQFTRILSSLAD
FT                   TYGHIFKTEQAEIDMRDVVVNRRILVTLLPALESSRPELGNLGKIVVAGVKGMMGSNLG
FT                   NIVEGSKRSVLDARATNAPTPFLTIFDEHGYYLTEDTALMWAQARSLGFWLISAGQDLQ
FT                   AYFRTSKEETKAILGSSNTKVIGKVEDPTETWEMIQAMGGEALISTLSDYDLDVDGVAG
FT                   GYMEGTSVKVERVKRIDLQDLQRQVEGEVHMLFGGDIIRGRIFYADPPSTSEFRLNHFI
FT                   KVLPPSTEGILSLKIDARRYIDQLHEPEIAFANQRPDDPYFSYAADLLRAPGVQKYKGN
FT                   RQGAELGVCLLTGFQTTPVINRGAVSGGGSAGGGLNAQPQPQPQPQPQPQSEEENSAVV
FT                   SASLTQRVDDGAAGEYFDAANLETTSVFAAVKPSPAVPGQPVFSAEESALYAATAVAAS
FT                   SLVDVAVAKDISSLFMDSQNGEPGPLDIEYTHAGLTALGQALGGTSAAASAAADAMIIT
FT                   AAEATSYPAPPTPPSSDVASTRMQSAMDELEALLGSSGAPNEL"
     MSIQGVDKRN EISRERLIRD TRPFFLRLLA GLGAPFAVAV AGLVLCVIAV FVPALADVCL        60
     LVGLLYALIP RRGVEDVPFR VPKYSGGVDP NEIDSKTGKP KRGRGIAFMG NRGQDDAECW       120
     GADTDVKRHW FFLGSTGAGK TEGLVSMCIN AFIWVSGLLY TDGKGDVSLY GKLFSSARIF       180
     GREDDFLLLN FMTGNADTQR KRSDKLSNNY NPFVDGNAAS KTQLLVNLMD SGGDGKGGDV       240
     WKGRAISFIA TVMPALIDKR DAGSLLLHVG RIREYLPFLK LLELLRDPDV LQDNKTRINA       300
     FLLDVPGYRA DKGEQQANTF FEQYGYQQMQ FTRILSSLAD TYGHIFKTEQ AEIDMRDVVV       360
     NRRILVTLLP ALESSRPELG NLGKIVVAGV KGMMGSNLGN IVEGSKRSVL DARATNAPTP       420
     FLTIFDEHGY YLTEDTALMW AQARSLGFWL ISAGQDLQAY FRTSKEETKA ILGSSNTKVI       480
     GKVEDPTETW EMIQAMGGEA LISTLSDYDL DVDGVAGGYM EGTSVKVERV KRIDLQDLQR       540
     QVEGEVHMLF GGDIIRGRIF YADPPSTSEF RLNHFIKVLP PSTEGILSLK IDARRYIDQL       600
     HEPEIAFANQ RPDDPYFSYA ADLLRAPGVQ KYKGNRQGAE LGVCLLTGFQ TTPVINRGAV       660
     SGGGSAGGGL NAQPQPQPQP QPQPQSEEEN SAVVSASLTQ RVDDGAAGEY FDAANLETTS       720
     VFAAVKPSPA VPGQPVFSAE ESALYAATAV AASSLVDVAV AKDISSLFMD SQNGEPGPLD       780
     IEYTHAGLTA LGQALGGTSA AASAAADAMI ITAAEATSYP APPTPPSSDV ASTRMQSAMD       840
     ELEALLGSSG APNEL                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page