(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMP

AM039951.ICMP        Location/Qualifiers
FT   CDS             45982..47133
FT                   /transl_table=11
FT                   /gene="icmP"
FT                   /locus_tag="XCVd0041"
FT                   /product="putative IcmP-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19853"
FT                   /db_xref="GOA:Q3C063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C063"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19853.1"
FT                   /translation="MRGRPNSEHDNGPVVVVLGLIVGIGLAWLVAHEQISWLVMWVRLL
FT                   EARVVFFDTEGLQMVYDWVASRHPRDVKIGELYSSGQVTGYYLRWVVLIVLLPMFGWMF
FT                   WRHPARSSAYRQVYSIMKLAWSQVHLYPMLKPILEMNLLTVPLDHPIHGMRALPRRYAR
FT                   RYKMLREMKDIAPDHDRSDLDVIDSKQVLVLSRCREVFAKQIGKEWAGIESLRGYERDL
FT                   LVAFAVQADGTIEDANKNTLQIIQELAIAASAAFKANDPGLIRSKRASELEARVMQSKV
FT                   VARAIRAHGYKRTVLMAMLEAGRKGGVLPAAWFRWLKPVDRVTWYCLCDMGIQPSCVES
FT                   AGARAQYLTERAAGIPVPTPMIEPAINGLREYLNEVIDVEVED"
     MRGRPNSEHD NGPVVVVLGL IVGIGLAWLV AHEQISWLVM WVRLLEARVV FFDTEGLQMV        60
     YDWVASRHPR DVKIGELYSS GQVTGYYLRW VVLIVLLPMF GWMFWRHPAR SSAYRQVYSI       120
     MKLAWSQVHL YPMLKPILEM NLLTVPLDHP IHGMRALPRR YARRYKMLRE MKDIAPDHDR       180
     SDLDVIDSKQ VLVLSRCREV FAKQIGKEWA GIESLRGYER DLLVAFAVQA DGTIEDANKN       240
     TLQIIQELAI AASAAFKAND PGLIRSKRAS ELEARVMQSK VVARAIRAHG YKRTVLMAML       300
     EAGRKGGVLP AAWFRWLKPV DRVTWYCLCD MGIQPSCVES AGARAQYLTE RAAGIPVPTP       360
     MIEPAINGLR EYLNEVIDVE VED                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page