(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMT

AM039951.ICMT        Location/Qualifiers
FT   CDS             9037..9318
FT                   /transl_table=11
FT                   /gene="icmT"
FT                   /locus_tag="XCVd0008"
FT                   /product="putative IcmT-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19820"
FT                   /db_xref="GOA:Q3C096"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C096"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19820.1"
FT                   /translation="MMSGPADWRNTSLMAKFLVFDARACIPFVILFYSPSFAKLGVSIG
FT                   LFLFFSVLSFYKYTLVVLVRRMRCKLAGPVRSGVAWWHRPQRRLYRHR"
     MMSGPADWRN TSLMAKFLVF DARACIPFVI LFYSPSFAKL GVSIGLFLFF SVLSFYKYTL        60
     VVLVRRMRCK LAGPVRSGVA WWHRPQRRLY RHR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page