(data stored in ACNUC9435 zone)

EMBL: AM039951.PARB

AM039951.PARB        Location/Qualifiers
FT   CDS             complement(3543..4424)
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="XCVd0003"
FT                   /product="Chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19815"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19815.1"
FT                   /translation="MSRGNIEAAGMSCDTAQSLPRDNTMARKIRSAQLTAHRPDRVDYD
FT                   PGTPRLLQSAEGARYRLLAGPAPALPDDLVGGLVLTDAETIAAAARLGTTSPAELTVIE
FT                   KIQLAIALADDVKATALCLLLGERNHPEVWRWTALKRAAQELRGAVLSGSLTRGHARPL
FT                   LPLPSQLQAEWTRRALRGRWSVRTLTSMVAREGKAGTPATPSPAAADTKHLEDQLSQRL
FT                   GSPVRLEWPEAPGTRSLIIGYSDMETLKGVLQELARGPEGTGHLGNAMRSLRIELADAD
FT                   ELDALTGHLLSE"
     MSRGNIEAAG MSCDTAQSLP RDNTMARKIR SAQLTAHRPD RVDYDPGTPR LLQSAEGARY        60
     RLLAGPAPAL PDDLVGGLVL TDAETIAAAA RLGTTSPAEL TVIEKIQLAI ALADDVKATA       120
     LCLLLGERNH PEVWRWTALK RAAQELRGAV LSGSLTRGHA RPLLPLPSQL QAEWTRRALR       180
     GRWSVRTLTS MVAREGKAGT PATPSPAAAD TKHLEDQLSQ RLGSPVRLEW PEAPGTRSLI       240
     IGYSDMETLK GVLQELARGP EGTGHLGNAM RSLRIELADA DELDALTGHL LSE              293
//

If you have problems or comments...

PBIL Back to PBIL home page