(data stored in ACNUC9435 zone)

EMBL: AM039951.PE10

AM039951.PE10        Location/Qualifiers
FT   CDS             10265..10798
FT                   /transl_table=11
FT                   /locus_tag="XCVd0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19822"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C094"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19822.1"
FT                   /translation="MAYIDYALDDANNWREGMDPTAPVVVVDVGGRTTDTATIIRGSTV
FT                   DHAASGTINVGVTHVLDHLRSLIMARFGVAGVRPSRLETFLRSGKVQLRGEWHDISAER
FT                   EQAVDLVLQQVRRELQRRVGDAADMQAVLLVGGGAALLASGLKTGYRHLVVPEDPEFAN
FT                   ARGMLKTLRGNVAA"
     MAYIDYALDD ANNWREGMDP TAPVVVVDVG GRTTDTATII RGSTVDHAAS GTINVGVTHV        60
     LDHLRSLIMA RFGVAGVRPS RLETFLRSGK VQLRGEWHDI SAEREQAVDL VLQQVRRELQ       120
     RRVGDAADMQ AVLLVGGGAA LLASGLKTGY RHLVVPEDPE FANARGMLKT LRGNVAA          177
//

If you have problems or comments...

PBIL Back to PBIL home page