(data stored in ACNUC9435 zone)

EMBL: AM039951.PE101

AM039951.PE101       Location/Qualifiers
FT   CDS             complement(111429..111830)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19913"
FT                   /db_xref="GOA:Q3C003"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C003"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19913.1"
FT                   /translation="MKRYMLDTNTVSHLVKSHPAVSRRVIEVPMTALCMSAITGGELMF
FT                   GLAKVPDAKRLQQAVMELLRRVDVLPWDGAVMERYGSVRADLEKQGKALGSLDMLIAAH
FT                   ALETDSVLVTNDAAFSRVVGLTVEDWTRS"
     MKRYMLDTNT VSHLVKSHPA VSRRVIEVPM TALCMSAITG GELMFGLAKV PDAKRLQQAV        60
     MELLRRVDVL PWDGAVMERY GSVRADLEKQ GKALGSLDML IAAHALETDS VLVTNDAAFS       120
     RVVGLTVEDW TRS                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page