(data stored in ACNUC9435 zone)

EMBL: AM039951.PE111

AM039951.PE111       Location/Qualifiers
FT   CDS             119094..119513
FT                   /transl_table=11
FT                   /locus_tag="XCVd0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19923"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19923.1"
FT                   /translation="MRVVLDTNVLLAALISSHSPPDIIYRGWLAARFELVTGTAQLDEL
FT                   RRVSRYPKIKAILPAHRVGTMINNMQRAVVLHVLPPLPDRIEVNDPNDAFLLAMALASE
FT                   ADYLVTGDRRAGLLQRGSIGRTRIVTPVTFCAEAL"
     MRVVLDTNVL LAALISSHSP PDIIYRGWLA ARFELVTGTA QLDELRRVSR YPKIKAILPA        60
     HRVGTMINNM QRAVVLHVLP PLPDRIEVND PNDAFLLAMA LASEADYLVT GDRRAGLLQR       120
     GSIGRTRIVT PVTFCAEAL                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page