(data stored in ACNUC9435 zone)

EMBL: AM039951.PE114

AM039951.PE114       Location/Qualifiers
FT   CDS             123354..124199
FT                   /transl_table=11
FT                   /locus_tag="XCVd0114"
FT                   /product="putative cointegrate resolution protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19926"
FT                   /db_xref="GOA:Q3BZZ0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19926.1"
FT                   /translation="MARYLAAYAGQLALNTLRHRLAALAQWHQAHGFADPTRAPVVRKV
FT                   LKGIQTVHPSQEKRATPLQLTQLGQVVDWLDGAATAAGTRDDAAGRLRHMRDRAFVLLG
FT                   FWRGFRGDELVRLQVQDLELVAGEGMTCFLPHSKSDRQHAGTTYKVPALSRWCPVAATM
FT                   AWVAAAALHEGPLFRAVNQWGGIAAAPLHPNSLVRLLRRIFREAGLSSPNDYSGHSLRR
FT                   GFAGWANANGWDVKALMEYVGWRDVQSAMRYIDGADPFARQRIEASLPEAPALPRPATT
FT                   "
     MARYLAAYAG QLALNTLRHR LAALAQWHQA HGFADPTRAP VVRKVLKGIQ TVHPSQEKRA        60
     TPLQLTQLGQ VVDWLDGAAT AAGTRDDAAG RLRHMRDRAF VLLGFWRGFR GDELVRLQVQ       120
     DLELVAGEGM TCFLPHSKSD RQHAGTTYKV PALSRWCPVA ATMAWVAAAA LHEGPLFRAV       180
     NQWGGIAAAP LHPNSLVRLL RRIFREAGLS SPNDYSGHSL RRGFAGWANA NGWDVKALME       240
     YVGWRDVQSA MRYIDGADPF ARQRIEASLP EAPALPRPAT T                           281
//

If you have problems or comments...

PBIL Back to PBIL home page