(data stored in ACNUC9435 zone)

EMBL: AM039951.PE116

AM039951.PE116       Location/Qualifiers
FT   CDS             127474..128784
FT                   /transl_table=11
FT                   /locus_tag="XCVd0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19928"
FT                   /db_xref="GOA:Q3BZY8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19928.1"
FT                   /translation="MGTNAAIEKTQQPPLRQATVLVPAAKMPEFTKRLEALNKKAAKFG
FT                   LDALTVELAHVTPYLQQRRVHGAGEEVTLVPWTTSAPLPADAVGLIDMHSLLLRFPLVK
FT                   LGDWHVVAQLDATPAAGALVFAVTDVADDRTEAARRRDHPMHCEHCHTARARKQIYLLR
FT                   NTNTGAYQQVGSTCLQDFTGIDPARALFLAKLADFQRYADALGDQAAAGAAGAVATLDY
FT                   LARVVFLCESSSFIPVSKARELRIDATYLQATELSDAHRRNPAAGRAFAAARERLQAEA
FT                   AAVVAWFAGREPTDAFEANVKAVLASDTIKADARHLATAAAAVPTYQRHQSAAQLLLRA
FT                   ARSAHVATEGDKLERPLRVYQVATIDSHFGPQERVSLVDDDGNCFTWRTAAAPGELLRP
FT                   SNRERRFDAGFKIKKHITSQGTAITEISHVRVKRWLP"
     MGTNAAIEKT QQPPLRQATV LVPAAKMPEF TKRLEALNKK AAKFGLDALT VELAHVTPYL        60
     QQRRVHGAGE EVTLVPWTTS APLPADAVGL IDMHSLLLRF PLVKLGDWHV VAQLDATPAA       120
     GALVFAVTDV ADDRTEAARR RDHPMHCEHC HTARARKQIY LLRNTNTGAY QQVGSTCLQD       180
     FTGIDPARAL FLAKLADFQR YADALGDQAA AGAAGAVATL DYLARVVFLC ESSSFIPVSK       240
     ARELRIDATY LQATELSDAH RRNPAAGRAF AAARERLQAE AAAVVAWFAG REPTDAFEAN       300
     VKAVLASDTI KADARHLATA AAAVPTYQRH QSAAQLLLRA ARSAHVATEG DKLERPLRVY       360
     QVATIDSHFG PQERVSLVDD DGNCFTWRTA AAPGELLRPS NRERRFDAGF KIKKHITSQG       420
     TAITEISHVR VKRWLP                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page