(data stored in ACNUC9435 zone)

EMBL: AM039951.PE117

AM039951.PE117       Location/Qualifiers
FT   CDS             129011..129280
FT                   /transl_table=11
FT                   /locus_tag="XCVd0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19929.1"
FT                   /translation="MLINGVVVDDIALDEVKDADKIVINGGVVFADENDRAGCSATSHF
FT                   NRWKKAQTTQFVSVQVSNDDVQALQELLAQFGQGRTNFKVTLGS"
     MLINGVVVDD IALDEVKDAD KIVINGGVVF ADENDRAGCS ATSHFNRWKK AQTTQFVSVQ        60
     VSNDDVQALQ ELLAQFGQGR TNFKVTLGS                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page