(data stored in ACNUC9435 zone)

EMBL: AM039951.PE118

AM039951.PE118       Location/Qualifiers
FT   CDS             129663..130436
FT                   /transl_table=11
FT                   /locus_tag="XCVd0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19930"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19930.1"
FT                   /translation="MVILCAQQNPKPHHQTRRNDREHDAMTHNEAITAPETSPQLVSIP
FT                   PQVIQAAAIASAGGAAEWNLLSARAQQEAHADCEVIIRTAVSALRQAGVASDGSDASTI
FT                   TTIRRLRAALELIATQGPHFGHDGTQETWMHWADIARKALTDQAAGYKHLSPQPDQIPT
FT                   ISQQREPSYWTETLLASAEKLRVRIGGQPDGDADDLERLAAAIRAPNGYIVKVGGAAYR
FT                   YDLCASTAAYAREAALATGLEPEDFTVEPFLVIHP"
     MVILCAQQNP KPHHQTRRND REHDAMTHNE AITAPETSPQ LVSIPPQVIQ AAAIASAGGA        60
     AEWNLLSARA QQEAHADCEV IIRTAVSALR QAGVASDGSD ASTITTIRRL RAALELIATQ       120
     GPHFGHDGTQ ETWMHWADIA RKALTDQAAG YKHLSPQPDQ IPTISQQREP SYWTETLLAS       180
     AEKLRVRIGG QPDGDADDLE RLAAAIRAPN GYIVKVGGAA YRYDLCASTA AYAREAALAT       240
     GLEPEDFTVE PFLVIHP                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page