(data stored in ACNUC9435 zone)

EMBL: AM039951.PE119

AM039951.PE119       Location/Qualifiers
FT   CDS             130456..130926
FT                   /transl_table=11
FT                   /locus_tag="XCVd0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19931"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19931.1"
FT                   /translation="MTPTSSRIQRVRQAGSEHQVVTVQSPKQASARYCKRPCPDCPWRV
FT                   DAVGKWPAEAFRASAETAYDMATHTFACHSAGATNPRLCAGFLLRGADHNLSVRLERMH
FT                   GRVGSDVEDGGQILYPSYVAMAVANGVPSNDPALQACRESYFEAQQVDSGEQ"
     MTPTSSRIQR VRQAGSEHQV VTVQSPKQAS ARYCKRPCPD CPWRVDAVGK WPAEAFRASA        60
     ETAYDMATHT FACHSAGATN PRLCAGFLLR GADHNLSVRL ERMHGRVGSD VEDGGQILYP       120
     SYVAMAVANG VPSNDPALQA CRESYFEAQQ VDSGEQ                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page