(data stored in ACNUC9435 zone)

EMBL: AM039951.PE120

AM039951.PE120       Location/Qualifiers
FT   CDS             130923..131813
FT                   /transl_table=11
FT                   /locus_tag="XCVd0120"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19932"
FT                   /db_xref="GOA:Q3BZY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19932.1"
FT                   /translation="MTTAPEVSDFAVNQPVLGKLTERALARFQKAIDRRKKRYLDFDKF
FT                   RDHAAARIRALASENEQIAYFLSYGFYVLEGGKTAGWDDSVVKVQFGSRPYLTAYSEPQ
FT                   LVYGEMSKSLRVFTEQGASLLYQRGDDGHVMCLLYPASSEREPKTVSMVVLKVVNDPSN
FT                   LLNDRLLRSHLKTLAAYMAVTSLDGSPTMLQRCRYWWLHLTKQRTIGGVVRPRQIQVIA
FT                   GKLLLWVATVAFSGIALFLIQRRWPEKDAVTPAVLQASQAAQRSARVKRSSECWNRSET
FT                   QWRHLLQPGRRHRRQ"
     MTTAPEVSDF AVNQPVLGKL TERALARFQK AIDRRKKRYL DFDKFRDHAA ARIRALASEN        60
     EQIAYFLSYG FYVLEGGKTA GWDDSVVKVQ FGSRPYLTAY SEPQLVYGEM SKSLRVFTEQ       120
     GASLLYQRGD DGHVMCLLYP ASSEREPKTV SMVVLKVVND PSNLLNDRLL RSHLKTLAAY       180
     MAVTSLDGSP TMLQRCRYWW LHLTKQRTIG GVVRPRQIQV IAGKLLLWVA TVAFSGIALF       240
     LIQRRWPEKD AVTPAVLQAS QAAQRSARVK RSSECWNRSE TQWRHLLQPG RRHRRQ           296
//

If you have problems or comments...

PBIL Back to PBIL home page