(data stored in ACNUC9435 zone)

EMBL: AM039951.PE121

AM039951.PE121       Location/Qualifiers
FT   CDS             131923..132363
FT                   /transl_table=11
FT                   /locus_tag="XCVd0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19933"
FT                   /db_xref="InterPro:IPR021686"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19933.1"
FT                   /translation="MHSEFDPWHPSSAAIARVKNALTAPTRHDCGGIVEIRSHREVFGR
FT                   NYGNWPWVYFCTHCRARVGMHPFTDIPLGTLADEPTRNARTAAKTLFEQLWRRADSPLS
FT                   RSAAYAWLANQLSLPMSACHFGLFDIATCERARLACRQYLEP"
     MHSEFDPWHP SSAAIARVKN ALTAPTRHDC GGIVEIRSHR EVFGRNYGNW PWVYFCTHCR        60
     ARVGMHPFTD IPLGTLADEP TRNARTAAKT LFEQLWRRAD SPLSRSAAYA WLANQLSLPM       120
     SACHFGLFDI ATCERARLAC RQYLEP                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page