(data stored in ACNUC9435 zone)

EMBL: AM039951.PE122

AM039951.PE122       Location/Qualifiers
FT   CDS             132385..133605
FT                   /transl_table=11
FT                   /locus_tag="XCVd0122"
FT                   /product="putative integrase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19934"
FT                   /db_xref="GOA:Q3BZY2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19934.1"
FT                   /translation="MTRPPAPRPTNEHTKRVRARSPYLVTPQARELQNALQALAAPPEG
FT                   PLVLADIPVVVLGVRFDLSPEQIERATAVLQDLYKHDIKPYADNSRKAIRSDWRHWVAF
FT                   CAQGDRVCMPVQLDDLVEFLNSLIAAGYKRATLEHLLFTLKLASRLWSCTCPTETLQFR
FT                   WYWQQQCREQLTARNHQAPALNVETVDNIVEAPTRASGLAGLLELRDMVYVSMSYDLLG
FT                   RASEMVRLRWSDVRFDADVDGGATCTIARSKTDQQGAGVALYLSPRSAHLLDTWQTQRL
FT                   LAADYLWPAARLEYLHNPYVFHRLPRHKLFKPGPTADAKRLRWDAHLNVREADRIIKRA
FT                   AGDQFSAHSARVGAAQDMTRAGMDLPAIMQQGRWNTPTMPARYAENELATRAGKNRQTA
FT                   LAKLKNS"
     MTRPPAPRPT NEHTKRVRAR SPYLVTPQAR ELQNALQALA APPEGPLVLA DIPVVVLGVR        60
     FDLSPEQIER ATAVLQDLYK HDIKPYADNS RKAIRSDWRH WVAFCAQGDR VCMPVQLDDL       120
     VEFLNSLIAA GYKRATLEHL LFTLKLASRL WSCTCPTETL QFRWYWQQQC REQLTARNHQ       180
     APALNVETVD NIVEAPTRAS GLAGLLELRD MVYVSMSYDL LGRASEMVRL RWSDVRFDAD       240
     VDGGATCTIA RSKTDQQGAG VALYLSPRSA HLLDTWQTQR LLAADYLWPA ARLEYLHNPY       300
     VFHRLPRHKL FKPGPTADAK RLRWDAHLNV READRIIKRA AGDQFSAHSA RVGAAQDMTR       360
     AGMDLPAIMQ QGRWNTPTMP ARYAENELAT RAGKNRQTAL AKLKNS                      406
//

If you have problems or comments...

PBIL Back to PBIL home page