(data stored in ACNUC9435 zone)

EMBL: AM039951.PE124

AM039951.PE124       Location/Qualifiers
FT   CDS             134115..135140
FT                   /transl_table=11
FT                   /locus_tag="XCVd0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19936"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19936.1"
FT                   /translation="MGGNALKTVATHRLSAASYRQLAAQVMDTLQSESGFRVELVRSFG
FT                   AKADFGDMDVIADRSTLPADVAALMRHLFNPHEVVSNGNVLSFDVAAFQVDLVCVPASE
FT                   YDTARDYFAFNDLGNLMGRTAHRMGFTYGHNGLRYKVRDGDYLVADLTVTSEMPAAFAF
FT                   LGYDYRRFDQGFHTLEEVFAFAASSAHFNPAAYPLESRGHRDRVRDQKRQNYRLFLEWL
FT                   QTAGVAAGASADLQREHHLQRALKQFPAFAEALSQSQEALAGARRRKQLFNGQIVAELT
FT                   GLEGRELGQLMRELHDAYPGGRAAFVSWLDQLQDHDLTPLHAYIEQVAADLDLQESKCH
FT                   P"
     MGGNALKTVA THRLSAASYR QLAAQVMDTL QSESGFRVEL VRSFGAKADF GDMDVIADRS        60
     TLPADVAALM RHLFNPHEVV SNGNVLSFDV AAFQVDLVCV PASEYDTARD YFAFNDLGNL       120
     MGRTAHRMGF TYGHNGLRYK VRDGDYLVAD LTVTSEMPAA FAFLGYDYRR FDQGFHTLEE       180
     VFAFAASSAH FNPAAYPLES RGHRDRVRDQ KRQNYRLFLE WLQTAGVAAG ASADLQREHH       240
     LQRALKQFPA FAEALSQSQE ALAGARRRKQ LFNGQIVAEL TGLEGRELGQ LMRELHDAYP       300
     GGRAAFVSWL DQLQDHDLTP LHAYIEQVAA DLDLQESKCH P                           341
//

If you have problems or comments...

PBIL Back to PBIL home page